LL-37 peptide 5 mg – Research Overview
LL-37 peptide is a synthetic research-grade antimicrobial peptide modeled after a naturally occurring component of the innate immune system. Researchers study LL-37 peptide in experimental models focused on cellular protection, immune signaling, and tissue integrity mechanisms. Therefore, LL-37 peptide has attracted long-term interest within immunological and biomedical research.
Scientists use LL-37 peptide to investigate defensive cellular responses and intercellular communication pathways. In this context, experimental models allow researchers to analyze how cells coordinate protection and signaling under conditions of biological stress. At the same time, research settings explore how LL-37 peptide contributes to the balance between cellular defense and tissue-level adaptive responses.
Unlike peptides limited to narrow immune pathways, LL-37 peptide provides a broad research model for studying innate immune regulation and barrier protection signaling. As a result, researchers can observe how immune-related peptides interact with cellular environments under controlled laboratory conditions.
LL-37 peptide in immune and cellular protection research
In immunological research, scientists frequently reference LL-37 peptide in experimental models examining immune regulation and cellular defense coordination. Additionally, these models support investigation of how innate immune peptides influence cell signaling, inflammatory balance, and protective responses.
Researchers also study LL-37 peptide in laboratory models focused on autoimmune-related signaling and immune system adaptability. Through these studies, research teams analyze how immune peptides participate in regulatory feedback mechanisms during complex biological states.
Moreover, LL-37 peptide appears in experimental research settings related to oncological and tumor-associated immune environments. These models help scientists explore how immune signaling pathways interact with cellular stress, tissue integrity, and regulatory balance.
LL-37 peptide in tissue integrity and barrier research
Due to its role in innate immune signaling, LL-37 peptide is often included in experimental models focused on skin, mucosal surfaces, and barrier tissues. Consequently, researchers use these models to study how cells maintain structural stability and adaptive protection at tissue interfaces.
Experimental research also examines LL-37 peptide in studies related to tissue repair signaling and regenerative coordination. In these contexts, scientists analyze how immune-related peptides support cellular resilience and adaptive tissue responses.
Public scientific databases, including PubChem, provide biochemical and molecular reference data for LL-37 peptide. Accordingly, researchers rely on these standardized resources when designing experimental protocols and validating laboratory research data.
Research handling and laboratory use
Laboratories handle LL-37 peptide exclusively in controlled research environments. Additionally, proper storage conditions and standardized handling procedures help maintain peptide stability and integrity. In turn, consistent laboratory protocols support reliable and reproducible research outcomes.
Therefore, all research involving LL-37 peptide remains limited to laboratory and experimental research models. Accordingly, these activities do not include clinical, therapeutic, or diagnostic use.
Important Notice
This product is intended exclusively for laboratory and scientific research purposes.
Not intended for human or veterinary use.
Not intended for diagnostic, therapeutic, or clinical applications.
|
Compound
|
LL-37
|
|
Chemical name
|
Human cathelicidin antimicrobial peptide (LL-37)
|
|
Quantity
|
5mg
|
|
Form
|
Lyophilized peptide powder
|
|
Purity
|
High-purity research grade
|
|
Packaging
|
Glass vial with sterile closure
|
|
Storage conditions
|
Store lyophilized at 2–8 °C. Keep desiccated and protected from light.
|
|
Molecular formula
|
C₂₀₅H₃₁₆N₆₀O₅₅
|
|
Molecular weight
|
≈ 4493.3 g/mol
|
|
sequence
|
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
|
|
CAS number
|
154947-66-7
|
0 reviews for LL-37 5 mg
Add a review
Your email address will not be published. Required fields are marked *
Your rating *